Structure of PDB 7c4r Chain A Binding Site BS01

Receptor Information
>7c4r Chain A (length=54) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKMWSVQESEWLKQGVVRYGVGHWERIRSAFPFAGRTAVNLKDRWRTMV
KLKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c4r Crystal structure of hydrogen peroxide treated zebrafish TRF2 myb-domain complexed with DNA
Resolution2.44 Å
Binding residue
(original residue number in PDB)		R522 G543 W545 E546 K563 R567
Binding residue
(residue number reindexed from 1)		R2 G23 W25 E26 K43 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance
GO:0031848 protection from non-homologous end joining at telomere
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c4r, PDBe:7c4r, PDBj:7c4r
PDBsum7c4r
PubMed
UniProtQ4FZZ9

[Back to BioLiP]