Structure of PDB 7c45 Chain A Binding Site BS01

Receptor Information
>7c45 Chain A (length=295) Species: 185431 (Trypanosoma brucei brucei TREU927) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SATSSSSMILKYPYRVVDTHEKLKEAVTSLQGARSIALDIEAFCTTDQAK
QLGRISLVQACSDAKPVVFLFDVLTLTPDVFVKDMQSLLSDREIRKLFFD
CRRDVEALSCQLGVKPEGVLDLQVFFTAIQWKLRSVNRRSGMGYVLKSVA
GLTRDSAVQTAMTLRPVWDIRPLPDHFLEYAAGDVRHILLLSNYLVGNKD
VPVDVVAVERLTAQYVEHYAVGKPVITEADATPAEVNRAWLERYIGPGGG
CHFCGAKGHTEAECFKKQNGKAKCSFCGEVGHTARNCFKKHPQLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c45 Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
Resolution1.769 Å
Binding residue
(original residue number in PDB)		E82 A83 L93 D141 Q164 R179 S181 G182 Y185 R195 M206 P279 A280 H305 E309 C310 F311 G327 H328 N332 C333 F334 K335
Binding residue
(residue number reindexed from 1)		E41 A42 L52 D100 Q123 R138 S140 G141 Y144 R154 M162 P233 A234 H259 E263 C264 F265 G281 H282 N286 C287 F288 K289
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
GO:0008408 3'-5' exonuclease activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7c45, PDBe:7c45, PDBj:7c45
PDBsum7c45
PubMed33332555
UniProtQ38DE2

[Back to BioLiP]