Structure of PDB 7c1m Chain A Binding Site BS01

Receptor Information

>7c1m Chain A (length=67) Species: 555311 (Saccharolobus solfataricus 98/2)

GSHMATVKFKYKGEEKQVDISKILSVGRYGKLIHFLYDLGGGKAGMGMVS
EKDAPKELLQMLEKQKK

Ligand information

>7c1m Chain B (length=10) Species: 9606 (Homo sapiens)

GEGEEEGEEY

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7c1m Genetically encoded live-cell sensor for tyrosinated microtubules.
• Resolution: N/A
• Binding residue (original residue number in PDB): Y11 K12 K16 Y29 G30 L32 H34 Y37 L39 K43 G45 M46 G47 M48
• Binding residue (residue number reindexed from 1): Y11 K12 K16 Y29 G30 L32 H34 Y37 L39 K43 G45 M46 G47 M48

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 12:21:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7c1m', asym_id = 'A', bs = 'BS01', title = 'Genetically encoded live-cell sensor for tyrosinated microtubules.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7c1m', asym_id='A', bs='BS01', title='Genetically encoded live-cell sensor for tyrosinated microtubules.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677,0004521', uniprot = '', pdbid = '7c1m', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0004521', uniprot='', pdbid='7c1m', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>