Structure of PDB 7c0j Chain A Binding Site BS01

Receptor Information
>7c0j Chain A (length=59) Species: 9031,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTYSEMIAAAIRAGSSRQSIQAYIKSHYHNKKEINRVLYSLLAAGVLKQT
GVPGSWALA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c0j Dual conformational recognition by Z-DNA binding protein is important for the B-Z transition process.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		K1169 K1170 N1173 R1174 Y1177 V88
Binding residue
(residue number reindexed from 1)		K31 K32 N35 R36 Y39 V52
Enzymatic activity
Enzyme Commision number ?
3.5.4.37: double-stranded RNA adenine deaminase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c0j, PDBe:7c0j, PDBj:7c0j
PDBsum7c0j
PubMed33245772
UniProtP02259|H5_CHICK Histone H5;
P55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)

[Back to BioLiP]