Structure of PDB 7c0g Chain A Binding Site BS01

Receptor Information

>7c0g Chain A (length=72) Species: 1223260 (Pseudomonas phage JBD30) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KTPDASNHDPDPRYLRGLLKKAGISQRRAAELLGLSDRVMRYYLSEDIKE
GYRPAPYTVQFALECLANDPPS

Ligand information

>7c0g Chain C (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggcacacgtgtgcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7c0g Aca1 in complex with 14bp palindromic DNA target
Resolution	2.4 Å
Binding residue (original residue number in PDB)	R44 Y48
Binding residue (residue number reindexed from 1)	R38 Y42

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7c0g, PDBe:7c0g, PDBj:7c0g
PDBsum	7c0g
PubMed
UniProt	L7P845

[Back to BioLiP]