Structure of PDB 7bu9 Chain A Binding Site BS01

Receptor Information
>7bu9 Chain A (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFD
CVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETED
GSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPD
PGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYV
YDLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bu9 Molecular basis for histone H3 "K4me3-K9me3/2" methylation pattern readout by Spindlin1.
Resolution3.502 Å
Binding residue
(original residue number in PDB)		W62 Y91 G93 F94 D95 C96 Y98 F141 E142 W151 D173 Y177 Y179 D184 F251
Binding residue
(residue number reindexed from 1)		W17 Y46 G48 F49 D50 C51 Y53 F96 E97 W106 D128 Y132 Y134 D139 F196
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:7bu9, PDBe:7bu9, PDBj:7bu9
PDBsum7bu9
PubMed32994220
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]