Structure of PDB 7bqv Chain A Binding Site BS01

Receptor Information
>7bqv Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKASN
LNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGL
TRSALLPTI
Ligand information
>7bqv Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SFVCSVCGHRFTTKGNLKVHFHRH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bqv Structural bases of IMiD selectivity that emerges by 5-hydroxythalidomide.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		N351 H353 Y355 H357 I371 R373 V388 H397 W400
Binding residue
(residue number reindexed from 1)		N34 H36 Y38 H40 I54 R56 V71 H80 W83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7bqv, PDBe:7bqv, PDBj:7bqv
PDBsum7bqv
PubMed32929090
UniProtQ96SW2|CRBN_HUMAN Protein cereblon (Gene Name=CRBN)

[Back to BioLiP]