Structure of PDB 7bqu Chain A Binding Site BS01

Receptor Information
>7bqu Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKASN
LNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGL
TRSALLPTI
Ligand information
>7bqu Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SFVCSVCGHRFTTKGNLKVHFHRH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bqu Structural bases of IMiD selectivity that emerges by 5-hydroxythalidomide.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		N351 H353 Y355 H357 I371 V388 A395 H397
Binding residue
(residue number reindexed from 1)		N34 H36 Y38 H40 I54 V71 A78 H80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7bqu, PDBe:7bqu, PDBj:7bqu
PDBsum7bqu
PubMed32929090
UniProtQ96SW2|CRBN_HUMAN Protein cereblon (Gene Name=CRBN)

[Back to BioLiP]