Structure of PDB 7bos Chain A Binding Site BS01

Receptor Information
>7bos Chain A (length=281) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPYDNLEK
YHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKG
LLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWM
KEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLV
MGTSLQVQPFASLISKAPLSTPRLLINKEKAGMDFDSKKAYRDVAWLGEC
DQGCLALAELLGWKKELEDLVRREHASIDAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bos Mechanism-based inhibitors of SIRT2: structure-activity relationship, X-ray structures, target engagement, regulation of alpha-tubulin acetylation and inhibition of breast cancer cell migration.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		E116 H187 V233 F235 G236 E237 Q265 V266 Q267
Binding residue
(residue number reindexed from 1)		E57 H128 V174 F176 G177 E178 Q206 V207 Q208
Enzymatic activity
Catalytic site (original residue number in PDB) P94 D95 F96 R97 N168 D170 H187
Catalytic site (residue number reindexed from 1) P39 D40 F41 R42 N109 D111 H128
Enzyme Commision number 2.3.1.-
2.3.1.286: protein acetyllysine N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0017136 NAD-dependent histone deacetylase activity
GO:0051287 NAD binding
GO:0070403 NAD+ binding

View graph for
Molecular Function
External links
PDB RCSB:7bos, PDBe:7bos, PDBj:7bos
PDBsum7bos
PubMed34458803
UniProtQ8IXJ6|SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 (Gene Name=SIRT2)

[Back to BioLiP]