Structure of PDB 7bo6 Chain A Binding Site BS01

Receptor Information

>7bo6 Chain A (length=238) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRLSMLPHLADLVSY
SIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSW
SCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAI
CLLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLA
DLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEV

Ligand information

>7bo6 Chain B (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7bo6 Lithocholic acid-based design of noncalcemic vitamin D receptor agonists.
Resolution	2.86 Å
Binding residue (original residue number in PDB)	I270 K274 R280 I288 K292 E446 E451
Binding residue (residue number reindexed from 1)	I56 K60 R66 I74 K78 E232 E237

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7bo6, PDBe:7bo6, PDBj:7bo6
PDBsum	7bo6
PubMed	33853023
UniProt	Q9PTN2\|VDRA_DANRE Vitamin D3 receptor A (Gene Name=vdra)

[Back to BioLiP]