Structure of PDB 7bk4 Chain A Binding Site BS01

Receptor Information
>7bk4 Chain A (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANEDMPVERILEAELAVEPKTETYVEANMNDPVTNICQAADKQLFTLVEW
AKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHV
HRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKG
LSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKC
LEHLFFFKLIGDTPIDTFLMEMLE
Ligand information
>7bk4 Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KHKILHRLLQDSSSPVDLAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bk4 Structural Insights into the Interaction of the Intrinsically Disordered Co-activator TIF2 with Retinoic Acid Receptor Heterodimer (RXR/RAR).
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K284 L294 V298 R302 F450 E453
Binding residue
(residue number reindexed from 1)		K52 L62 V66 R70 F218 E221
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bk4, PDBe:7bk4, PDBj:7bk4
PDBsum7bk4
PubMed33647291
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]