Structure of PDB 7b4w Chain A Binding Site BS01

Receptor Information
>7b4w Chain A (length=161) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGATPLHLAAWTGHLE
IVEVLLKTGADVNAVDSVGYTPLHLAAAEGHLEIVEVLLKTGADVNAQDA
QGITPLHLAAWYGHLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDI
AEVLQKAAKLN
Ligand information
>7b4w Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIRIGPGQAFYAPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b4w Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		W56 D77 V79 Y81 L86 A89 Q112 W122 Y123 D143 F145
Binding residue
(residue number reindexed from 1)		W45 D66 V68 Y70 L75 A78 Q101 W111 Y112 D132 F134
External links