Structure of PDB 7b4v Chain A Binding Site BS01

Receptor Information
>7b4v Chain A (length=128) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLGKKLLEAARAGQDDEVRILMANGADVNASDADVGATPLHLAAWAGHLE
IVEVLLKTGADVNAVDIWGLTPLHLAAAVGHLEIVEVLLKHGADVNAQDK
FGKTPFDLAIDNGNEDIAEVLQKAAKLN
Ligand information
>7b4v Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIRIGPGQAFYAPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b4v Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		V47 A49 W57 D78 W80 L87 F113 N124
Binding residue
(residue number reindexed from 1)		V35 A37 W45 D66 W68 L75 F101 N112
External links