Structure of PDB 7b4t Chain A Binding Site BS01

Receptor Information
>7b4t Chain A (length=162) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPGSDLGKKLLEAARAGQDDEVRILMANGADVNADDNTGETPLHLAAYEG
HLEIVEVLLKTGADVNAEDMMGFTPLHLAAAWGHLEIVEVLLKHGADVNA
QDNQGVTPLHLAAYEGHLEFVEVLLKHGADVNAQDKFGKTPFDLAIDNGN
EDIAEVLQKAAK
Ligand information
>7b4t Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIRIGPGQAFYAPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b4t Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		E48 Y56 M78 M79 F81 A89 W90 Q112 L119 E123 D143 F145 L152
Binding residue
(residue number reindexed from 1)		E40 Y48 M70 M71 F73 A81 W82 Q104 L111 E115 D135 F137 L144
External links