Structure of PDB 7b3k Chain A Binding Site BS01

Receptor Information
>7b3k Chain A (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLV
MPKKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b3k All - d - Enantiomeric Peptide D3 Designed for Alzheimer's Disease Treatment Dynamically Interacts with Membrane-Bound Amyloid-beta Precursors.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y10 E11 H13 V18 E22 D23 K28 I31 I32
Binding residue
(residue number reindexed from 1)		Y10 E11 H13 V18 E22 D23 K28 I31 I32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:7b3k, PDBe:7b3k, PDBj:7b3k
PDBsum7b3k
PubMed34739758
UniProtP05067|A4_HUMAN Amyloid-beta precursor protein (Gene Name=APP)

[Back to BioLiP]