Structure of PDB 7ars Chain A Binding Site BS01

Receptor Information
>7ars Chain A (length=35) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSEEEIQRIFGLSSEQIKSLPEEKYKKKVEKTGYM
Ligand information
>7ars Chain B (length=27) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LSEEEIQRIFGLSLPEEKYKKKVEKTG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ars A computationally designed beta-amino acid-containing miniprotein.
Resolution1.15 Å
Binding residue
(original residue number in PDB)		L1 F10 L20 P21 Y25 X28 X31
Binding residue
(residue number reindexed from 1)		L1 F10 L20 P21 Y25 X28 X31
External links