Structure of PDB 7alo Chain A Binding Site BS01

Receptor Information
>7alo Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7alo Exchange catalysis by tapasin exploits conserved and allele-specific features of MHC-I molecules.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y7 H9 T24 E45 R62 E63 I66 C67 T73 D77 L81 Y84 Y99 H116 T143 W147 V152 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 H9 T24 E45 R62 E63 I66 C67 T73 D77 L81 Y84 Y99 H116 T143 W147 V152 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links