Structure of PDB 7al2 Chain A Binding Site BS01

Receptor Information
>7al2 Chain A (length=85) Species: 420247 (Methanobrevibacter smithii ATCC 35061) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YEIMLIRPKTIDDINYVVDQVLEESNPVILDLSFLEKESPANFKLAGEKI
KQMRSNYGAEALLLSRCNDKNLIIIAPKGVSLVRK
Ligand information
>7al2 Chain B (length=10) Species: 483214 (Methanobrevibacter smithii DSM 2375) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QLDDFIDGIF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7al2 SepF is the FtsZ anchor in archaea, with features of an ancestral cell division system.
Resolution2.701 Å
Binding residue
(original residue number in PDB)		E100 F107 G111 K115 R118 E124 A125 L126 L127 L128 R130 N135 I137 R148
Binding residue
(residue number reindexed from 1)		E36 F43 G47 K51 R54 E60 A61 L62 L63 L64 R66 N71 I73 R84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0090529 cell septum assembly

View graph for
Biological Process
External links
PDB RCSB:7al2, PDBe:7al2, PDBj:7al2
PDBsum7al2
PubMed34088904
UniProtA5UK83

[Back to BioLiP]