Structure of PDB 7act Chain A Binding Site BS01

Receptor Information
>7act Chain A (length=137) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRR
IRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPK
DHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7act Structural basis of RNA recognition by the SARS-CoV-2 nucleocapsid phosphoprotein.
ResolutionN/A
Binding residue
(original residue number in PDB)		K61 K65 R88 R89 A90 T91 R92 R93 I94 R95 D98 G99 K102 L104 R107 Y109 D128 K169 F171 Y172 A173 G175 R177
Binding residue
(residue number reindexed from 1)		K18 K22 R45 R46 A47 T48 R49 R50 I51 R52 D55 G56 K59 L61 R64 Y66 D85 K126 F128 Y129 A130 G132 R134
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7act, PDBe:7act, PDBj:7act
PDBsum7act
PubMed33264373
UniProtP0DTC9|NCAP_SARS2 Nucleoprotein (Gene Name=N)

[Back to BioLiP]