Structure of PDB 7abb Chain A Binding Site BS01

Receptor Information

>7abb Chain A (length=360) Species: 168695 (Salinispora tropica)

SVEFDFFAAPQAYRRVAAEHRADGAFHSSRGDSFWVLSTYEGICAAFRDE
DTFSVSERWIPLTIQGRTHNEWRRRLAAWFTPQRARDLTPAIRANARRRI
SAFVDRGEVSFSDEFARPYVLENLMLAVGWPLADLDHLLAINVAMIRSFN
AETAFPALQEYVRRHVARRRTEPVEGDLTSATFDWEIDGTPVSDADRESL
LTVLFLAGVDSTVNHMANGIQHLAHHPGDRHRFLRDPEVRPAAVEEFLRV
NSCMYPGRLATREGAGGVASQGDTVLLPLALANYDPAVFPEPERVDFDRE
QNPHIAFGTGHHQCLGAAYARAQILTAWEEWHELIPDYRLPDPTVEPPFL
RNVYDLRIVW

Ligand information

• Ligand ID: HEC
• InChI: InChI=1S/C34H34N4O4.Fe/c1-7-21-17(3)25-13-26-19(5)23(9-11-33(39)40)31(37-26)16-32-24(10-12-34(41)42)20(6)28(38-32)15-30-22(8-2)18(4)27(36-30)14-29(21)35-25;/h7-8,13-16H,9-12H2,1-6H3,(H,39,40)(H,41,42);/q-4;+4/b21-7?,22-8?,26-13-,29-14-,30-15-,31-16-;
• InChIKey: HXQIYSLZKNYNMH-LJNAALQVSA-N
• SMILES:
  ACDLabs 10.04: O=C(O)CCC1=C(C2=CC6=C(C(=C/C)\C5=CC4=C(C(\C3=Cc7c(c(c8C=C1N2[Fe](N34)(N56)n78)CCC(=O)O)C)=C/C)C)C)C
  OpenEye OEToolkits 1.5.0: CC=C1C(=C2C=C3C(=CC)C(=C4N3[Fe]56N2C1=Cc7n5c(c(c7C)CCC(=O)O)C=C8N6C(=C4)C(=C8CCC(=O)O)C)C)C
  CACTVS 3.341: C\C=C1/C(=C2C=C3N4C(=Cc5n6c(C=C7N8C(=C(C)\C7=C/C)C=C1N2[Fe@@]468)c(C)c5CCC(O)=O)C(=C3C)CCC(O)=O)C
  CACTVS 3.341: CC=C1C(=C2C=C3N4C(=Cc5n6c(C=C7N8C(=C(C)C7=CC)C=C1N2[Fe]468)c(C)c5CCC(O)=O)C(=C3C)CCC(O)=O)C
• Formula: C34 H34 Fe N4 O4
• Name: HEME C
• PDB chain: 7abb Chain A Residue 501

Receptor-Ligand Complex Structure

Structure summary

Jmol._Canvas2D (Jmol) "jmolApplet0"[x]

loadScript jsmol/j2s/core/package.js

loadScript jsmol/j2s/core/corejmol.z.js

loadScript jsmol/j2s/core/corescript.z.js

JSmol exec jmolApplet1 start applet null

Jmol JavaScript applet jmolApplet1__9190883556372436__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet1__9190883556372436__)

vwrOptions:

{ "name":"jmolApplet1","applet":true,"documentBase":"https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=A&pdb=7abb","platform":"J.awtjs2d.Platform","fullName":"jmolApplet1__9190883556372436__","codePath":"https://zhanglab.comp.nus.edu.sg/BioLiP/jsmol/j2s/","display":"jmolApplet1_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"9190883556372436","bgcolor":"#FFFFFF" }

setting document base to "https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=A&pdb=7abb"

(C) 2015 Jmol Development

Jmol Version: 14.32.79 2022-10-26 15:52

java.vendor: Java2Script (HTML5)

java.version: 2022-06-24 05:54:49 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet1 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor #FFFFFF

backgroundColor = "#FFFFFF"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

StatusManager callback set for APPLETREADYCallback f=Jmol._readyCallback cb=APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue MODELKITCallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SELECTCallback null

Jmol getValue SERVICECallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue SYNCCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet1__9190883556372436__ ready

script 1 started

script 1 started

Jmol._Canvas2D (Jmol) "jmolApplet1"[x]

loadScript jsmol/j2s/core/corebio.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__9190883556372436__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__9190883556372436__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=A&pdb=7abb","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__9190883556372436__","codePath":"https://zhanglab.comp.nus.edu.sg/BioLiP/jsmol/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"9190883556372436","bgcolor":"#FFFFFF" }

setting document base to "https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS01&chain=A&pdb=7abb"

(C) 2015 Jmol Development

Jmol Version: 14.32.79 2022-10-26 15:52

java.vendor: Java2Script (HTML5)

java.version: 2022-06-24 05:54:49 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor #FFFFFF

backgroundColor = "#FFFFFF"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

StatusManager callback set for APPLETREADYCallback f=Jmol._readyCallback cb=APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue MODELKITCallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SELECTCallback null

Jmol getValue SERVICECallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue SYNCCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__9190883556372436__ ready

• PDB: 7abb Characterization of the Stereoselective P450 Enzyme BotCYP Enables the In Vitro Biosynthesis of the Bottromycin Core Scaffold.
• Resolution: 1.50004 Å
• Binding residue (original residue number in PDB): P92 L93 H100 R104 A247 G248 S251 T252 H255 M294 P296 R298 F347 H352 C354 L355 G356
• Binding residue (residue number reindexed from 1): P61 L62 H69 R73 A207 G208 S211 T212 H215 M254 P256 R258 F307 H312 C314 L315 G316
• Annotation score: 4

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Apr 29 14:00:07 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7abb', asym_id = 'A', bs = 'BS01', title = 'Characterization of the Stereoselective P450 Enz...ro Biosynthesis of the Bottromycin Core Scaffold.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7abb', asym_id='A', bs='BS01', title='Characterization of the Stereoselective P450 Enz...ro Biosynthesis of the Bottromycin Core Scaffold.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004497,0005506,0016705,0020037', uniprot = '', pdbid = '7abb', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004497,0005506,0016705,0020037', uniprot='', pdbid='7abb', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>

Application loaded.