Structure of PDB 7a79 Chain A Binding Site BS01

Receptor Information
>7a79 Chain A (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMDMPVERILEAELAVETNDPVTNICHAADKQLFTLVEWAKRIPHFSDLT
LEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVG
SIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLR
EKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLETP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a79 Comprehensive Set of Tertiary Complex Structures and Palmitic Acid Binding Provide Molecular Insights into Ligand Design for RXR Isoforms.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		F278 V281 K285 L295 V299 R303 F451 E454
Binding residue
(residue number reindexed from 1)		F34 V37 K41 L51 V55 R59 F207 E210
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a79, PDBe:7a79, PDBj:7a79
PDBsum7a79
PubMed33187070
UniProtP48443|RXRG_HUMAN Retinoic acid receptor RXR-gamma (Gene Name=RXRG)

[Back to BioLiP]