Structure of PDB 7a78 Chain A Binding Site BS01

Receptor Information
>7a78 Chain A (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMPVDRILEAELAVENDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDD
QVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIF
DRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKV
YASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTP
IDTFLMEMLEAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a78 Comprehensive Set of Tertiary Complex Structures and Palmitic Acid Binding Provide Molecular Insights into Ligand Design for RXR Isoforms.
Resolution1.72 Å
Binding residue
(original residue number in PDB)		V351 K355 L365 Q368 V369 R373 T520 F521 E524 E527
Binding residue
(residue number reindexed from 1)		V34 K38 L48 Q51 V52 R56 T203 F204 E207 E210
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a78, PDBe:7a78, PDBj:7a78
PDBsum7a78
PubMed33187070
UniProtP28702|RXRB_HUMAN Retinoic acid receptor RXR-beta (Gene Name=RXRB)

[Back to BioLiP]