Structure of PDB 7a4t Chain A Binding Site BS01

Receptor Information
>7a4t Chain A (length=121) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGGGLVQAGGSLRLSCAASGSIFSINVMGWYRQAPGKQRELLAS
ITSRGSTNYADSVKDRFTISRDNAKNTVYLQINSLKPEDTAVYYCNSRGW
TTTRGDYDYWGQGTQVTVSSG
Ligand information
>7a4t Chain B (length=26) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QLEDKVEELLSKNYHLENEVERLKKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a4t A nanobody toolbox targeting dimeric coiled-coil modules for functionalization of designed protein origami structures.
Resolution2.124 Å
Binding residue
(original residue number in PDB)		W100 T102
Binding residue
(residue number reindexed from 1)		W100 T102
External links