Structure of PDB 7a1o Chain A Binding Site BS01

Receptor Information
>7a1o Chain A (length=347) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRA
EELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLY
YDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLND
TVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDE
QQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERF
PNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPT
PKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Ligand information
>7a1o Chain B (length=19) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LEVVKLLLEAGADVNAQDK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a1o 2-Oxoglutarate derivatives can selectively enhance or inhibit the activity of human oxygenases.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		Y102 D104 E105 K106 H199 D201 E202 Q203 R238 Q239 W296 K304 I306 A317 I318 N321
Binding residue
(residue number reindexed from 1)		Y100 D102 E103 K104 H197 D199 E200 Q201 R236 Q237 W294 K302 I304 A315 I316 N319
Enzymatic activity
Enzyme Commision number 1.14.11.30: hypoxia-inducible factor-asparagine dioxygenase.
1.14.11.n4: ankyrin-repeat-histidine dioxagenase.
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
GO:0005112 Notch binding
GO:0005515 protein binding
GO:0008198 ferrous iron binding
GO:0008270 zinc ion binding
GO:0019826 oxygen sensor activity
GO:0031406 carboxylic acid binding
GO:0036139 peptidyl-histidine dioxygenase activity
GO:0036140 [protein]-asparagine 3-dioxygenase activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0051059 NF-kappaB binding
GO:0051213 dioxygenase activity
GO:0062101 peptidyl-aspartic acid 3-dioxygenase activity
GO:0071532 ankyrin repeat binding
Biological Process
GO:0045663 positive regulation of myoblast differentiation
GO:0045746 negative regulation of Notch signaling pathway
GO:0045892 negative regulation of DNA-templated transcription
GO:2001214 positive regulation of vasculogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a1o, PDBe:7a1o, PDBj:7a1o
PDBsum7a1o
PubMed34759269
UniProtQ9NWT6|HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor (Gene Name=HIF1AN)

[Back to BioLiP]