Structure of PDB 7a1i Chain A Binding Site BS01

Receptor Information
>7a1i Chain A (length=107) Species: 630700 (Trypanosoma brucei equiperdum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GISICVATDCDGEKVNLRFLFDAAGPSVSRLLNYSTTAFNNYFRLKGISR
AFAVNSAVVFNDVHCTWDRLERTTQLLHNSQVYLFQPDTLDIPAAIPEPY
EGEPLLS
Ligand information
>7a1i Chain B (length=7) Species: 630700 (Trypanosoma brucei equiperdum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VLTSPVP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a1i Structural and functional studies of the first tripartite protein complex at the Trypanosoma brucei flagellar pocket collar.
Resolution1.87 Å
Binding residue
(original residue number in PDB)		K17 F63 W70 Q84 Y86 F88 P96 A97 A98 I99
Binding residue
(residue number reindexed from 1)		K14 F60 W67 Q81 Y83 F85 P93 A94 A95 I96
Enzymatic activity
Enzyme Commision number ?
External links