Structure of PDB 6zvq Chain A Binding Site BS01

Receptor Information
>6zvq Chain A (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGL
LSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQR
YGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIR
MSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSS
MS
Ligand information
>6zvq Chain B (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGLQKTLEQFHLSSMSSLGGPAAFSAR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zvq Mutations in SKI in Shprintzen-Goldberg syndrome lead to attenuated TGF-beta responses through SKI stabilization.
Resolution2.03 Å
Binding residue
(original residue number in PDB)		S269 E270 Y340 G342 G343 N387 Q388 F390 A391 Q447 W448 K451 Q455
Binding residue
(residue number reindexed from 1)		S4 E5 Y75 G77 G78 N122 Q123 F125 A126 Q182 W183 K186 Q190
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:6zvq, PDBe:6zvq, PDBj:6zvq
PDBsum6zvq
PubMed33416497
UniProtQ15796|SMAD2_HUMAN Mothers against decapentaplegic homolog 2 (Gene Name=SMAD2)

[Back to BioLiP]