Structure of PDB 6zot Chain A Binding Site BS01

Receptor Information

>6zot Chain A (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAY
RSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAKGKFEVKWIFVKDVP
NNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDD

Ligand information

>6zot Chain C (length=4) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gacu

....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6zot Structural and Dynamic Insights into Redundant Function of YTHDF Proteins.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	R520 N526
Binding residue (residue number reindexed from 1)	R108 N114

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6zot, PDBe:6zot, PDBj:6zot
PDBsum	6zot
PubMed	33073985
UniProt	Q7Z739\|YTHD3_HUMAN YTH domain-containing family protein 3 (Gene Name=YTHDF3)

[Back to BioLiP]