Structure of PDB 6zlc Chain A Binding Site BS01

Receptor Information

>6zlc Chain A (length=77) Species: 437402 (Influenza A virus (A/turkey/Italy/977/1999(H7N1))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSHMSDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGR
GSTLGLDLRVATMEGKKIVEDILKSET

Ligand information

>6zlc Chain C (length=19) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agacagcauuaugcugucu

...................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6zlc Structure and Sequence Determinants Governing the Interactions of RNAs with Influenza A Virus Non-Structural Protein NS1.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	S-2 H-1 S1 D2 T5 D34 R35 R38
Binding residue (residue number reindexed from 1)	S2 H3 S5 D6 T9 D38 R39 R42

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6zlc, PDBe:6zlc, PDBj:6zlc
PDBsum	6zlc
PubMed	32867106
UniProt	Q1PST0

[Back to BioLiP]