Structure of PDB 6zix Chain A Binding Site BS01

Receptor Information
>6zix Chain A (length=202) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAH
VLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDL
DIEGIVLKQGAPTDLPKALAALQKGESVSRLLEKISAGGYGDKRLSPKES
EVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLS
SV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zix Structure-based analyses of Salmonella RcsB variants unravel new features of the Rcs regulon.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		L167 V168 T169 I179 S183
Binding residue
(residue number reindexed from 1)		L161 V162 T163 I173 S177
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6zix, PDBe:6zix, PDBj:6zix
PDBsum6zix
PubMed33638994
UniProtP58663|RCSB_SALTY Transcriptional regulatory protein RcsB (Gene Name=rcsB)

[Back to BioLiP]