Structure of PDB 6z7z Chain A Binding Site BS01

Receptor Information

>6z7z Chain A (length=211) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIQMTQSPSSLSASLGGRVTITCKASQDINKYLAWYQHKPGKGPRLLIHY
TSTLQPGIPSRFSGSGSGRDYSFSISNLEPEDVATYYCLQYDSLLSFGAG
TKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKID
GSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTS
TSPIVKSFNRN

Ligand information

>6z7z Chain G (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6z7z Insulin binding to the analytical antibody sandwich pair OXI-005 and HUI-018: Epitope mapping and binding properties.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	D92 S93 L94
Binding residue (residue number reindexed from 1)	D92 S93 L94

External links

PDB	RCSB:6z7z, PDBe:6z7z, PDBj:6z7z
PDBsum	6z7z
PubMed	33277949

[Back to BioLiP]