Structure of PDB 6z3t Chain A Binding Site BS01

Receptor Information
>6z3t Chain A (length=382) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRGTL
MELGISPIVTSGLIMQLLAGARALFNGAQKLFGMIITIGQSIVYVMTLLI
TIQLFVAGLIVLLLDELLGISLFIATNICETIVWKAFSPTTVNTGRGMEF
EGAIIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATIFVFAVVIYFQ
GFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSNLYVISQMLS
ARFSPVGGLCHYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEV
SGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALS
VLADFLGAIGSGTGILLAVTIIYQYFEIFVKE
Ligand information
>6z3t Chain C (length=20) Species: 9615 (Canis lupus familiaris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z3t Structure of the Inhibited State of the Sec Translocon.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		V44 L50
Binding residue
(residue number reindexed from 1)		V18 L24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005048 signal sequence binding
GO:0005515 protein binding
GO:0008320 protein transmembrane transporter activity
GO:0043022 ribosome binding
Biological Process
GO:0006613 cotranslational protein targeting to membrane
GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
GO:0015031 protein transport
GO:0031204 post-translational protein targeting to membrane, translocation
GO:0039019 pronephric nephron development
GO:0045047 protein targeting to ER
GO:0045048 protein insertion into ER membrane
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005784 Sec61 translocon complex
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6z3t, PDBe:6z3t, PDBj:6z3t
PDBsum6z3t
PubMed32692975
UniProtP38377|S61A1_CANLF Protein transport protein Sec61 subunit alpha isoform 1 (Gene Name=SEC61A1)

[Back to BioLiP]