Structure of PDB 6yym Chain A Binding Site BS01

Receptor Information
>6yym Chain A (length=148) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRNSVDYAQIASGIDTRTTVMIKNIPNKFTQQMLRDYIDVTNKGTYDFLY
LRIDFVNKCNVGYAFINFIEPQSIITFGKARVGTQWNVFHSEKICDISYA
NIQGKDRLIEKFRNSCVMDENPAYRPKIFVSHGPNRGMEEPFPAPNNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yym A scaffold lncRNA shapes the mitosis to meiosis switch.
Resolution2.63 Å
Binding residue
(original residue number in PDB)		N582 M600 N603 N606 K607 Y629 R631 I632 D633 F634 V635 C638 V640 G641 Y642 F644 F668 H669 S670 K672 S677 Y678 A679 N680 I681 K690 F691 C695
Binding residue
(residue number reindexed from 1)		N3 M21 N24 N27 K28 Y50 R52 I53 D54 F55 V56 C59 V61 G62 Y63 F65 F89 H90 S91 K93 S98 Y99 A100 N101 I102 K111 F112 C116
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6yym, PDBe:6yym, PDBj:6yym
PDBsum6yym
PubMed33536434
UniProtP08965|MEI2_SCHPO Meiosis protein mei2 (Gene Name=mei2)

[Back to BioLiP]