Structure of PDB 6yxk Chain A Binding Site BS01

Receptor Information
>6yxk Chain A (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQPGAEVMQPGASMKVPCETSGYIFNDYYLHWVRQAPGLGLEWMGWI
APKTGVTKFAQKFQGRVNMTADSSVNTSYLEMTGLTFDDTAVYFCARGTY
LPVDESAAFDVWGLGTDVTVSSASTKGPSVFPLAPSSKSGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLFSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKRVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yxk Surface Ig variable domain glycosylation affects autoantigen binding and acts as threshold for human autoreactive B cell activation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y33 H35 W50 T100 D105 E106 S107 A108
Binding residue
(residue number reindexed from 1)		Y32 H34 W49 T99 D104 E105 S106 A107
External links