Structure of PDB 6yx2 Chain A Binding Site BS01

Receptor Information
>6yx2 Chain A (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDYIIKEKTVLLQKKDSEGFGFVLRGAKEFTPTPAFPALQYLESVD
EGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV
TRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yx2 Identification of beta-strand mediated protein-protein interaction inhibitors using ligand-directed fragment ligation.
Resolution1.62 Å
Binding residue
(original residue number in PDB)
G673 F674 F676 V677 L678 D706 H735
Binding residue
(residue number reindexed from 1)
G23 F24 F26 V27 L28 D50 H79
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6yx2, PDBe:6yx2, PDBj:6yx2
PDBsum6yx2
PubMed34163995
UniProtQ9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 (Gene Name=SHANK1)

[Back to BioLiP]