Structure of PDB 6yw3 Chain A Binding Site BS01

Receptor Information
>6yw3 Chain A (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGK
FTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCN
GKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDW
DAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRY
AITVWYFDADERARAKVKYLTGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yw3 Use of cyclic peptides to induce crystallization: case study with prolyl hydroxylase domain 2.
Resolution2.279 Å
Binding residue
(original residue number in PDB)		K186 P187 L188 A190 Y197 C201 K204 H205 V209 V210 D211 D212 F213
Binding residue
(residue number reindexed from 1)		K2 P3 L4 A6 Y13 C17 K20 H21 V25 V26 D27 D28 F29
Enzymatic activity
Enzyme Commision number 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418 L-ascorbic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6yw3, PDBe:6yw3, PDBj:6yw3
PDBsum6yw3
PubMed33319810
UniProtQ9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)

[Back to BioLiP]