Structure of PDB 6yw1 Chain A Binding Site BS01

Receptor Information
>6yw1 Chain A (length=209) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKF
TDGQDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGR
TKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRI
FPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADE
RARAKVKYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yw1 Use of cyclic peptides to induce crystallization: case study with prolyl hydroxylase domain 2.
Resolution1.46 Å
Binding residue
(original residue number in PDB)
K186 P187 L188 A190 Y197 P200 C201 K204 H205 I207 V209 V210 D211 D212 F213
Binding residue
(residue number reindexed from 1)
K1 P2 L3 A5 Y12 P15 C16 K19 H20 I22 V24 V25 D26 D27 F28
Enzymatic activity
Enzyme Commision number 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418 L-ascorbic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6yw1, PDBe:6yw1, PDBj:6yw1
PDBsum6yw1
PubMed33319810
UniProtQ9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)

[Back to BioLiP]