Structure of PDB 6yrb Chain A Binding Site BS01

Receptor Information
>6yrb Chain A (length=100) Species: 1980456 (Orthohantavirus andesense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTVFCTLAGPGASCEAYSENGIFNISSPTCLVNKVSEQKINFICQRVDQD
VVVYCNGQKKVILTKTLVIGQCIYTFTSLFSLMPDVAHSLAVELCVPGLH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yrb The Hantavirus Surface Glycoprotein Lattice and Its Fusion Control Mechanism.
Resolution2.351 Å
Binding residue
(original residue number in PDB)		T380 V381 F382 C383 Q441 K443 V444 I445 T449 L450 V475 V479
Binding residue
(residue number reindexed from 1)		T2 V3 F4 C5 Q58 K60 V61 I62 T66 L67 V92 V96
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6yrb, PDBe:6yrb, PDBj:6yrb
PDBsum6yrb
PubMed32937107
UniProtQ9E006|GP_ANDV Envelopment polyprotein (Gene Name=GP)

[Back to BioLiP]