Structure of PDB 6yqk Chain A Binding Site BS01

Receptor Information

>6yqk Chain A (length=346) Species: 10029 (Cricetulus griseus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GHMGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIK
TLGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPF
LVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVL
TFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTP
EYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDW
IAIYQRKVEAPFIPKFKGPGDTSNFDDYEEIRVSINEKCGKEFTEF

Ligand information

>6yqk Chain B (length=13) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AGRTGRRQAIHDI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6yqk Two Methods, One Goal: Structural Differences between Cocrystallization and Crystal Soaking to Discover Ligand Binding Poses.
Resolution	1.67 Å
Binding residue (original residue number in PDB)	E127 F129 R133 E170 F187 L198 C199 G200 T201 E203 E230 F239 A240 D241 Y247
Binding residue (residue number reindexed from 1)	E125 F127 R131 E168 F185 L196 C197 G198 T199 E201 E228 F237 A238 D239 Y245

Enzymatic activity

Catalytic site (original residue number in PDB)	D166 K168 N171 D184 T201
Catalytic site (residue number reindexed from 1)	D164 K166 N169 D182 T199
Enzyme Commision number	2.7.11.11: cAMP-dependent protein kinase.

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0004679	AMP-activated protein kinase activity
GO:0004691	cAMP-dependent protein kinase activity
GO:0004712	protein serine/threonine/tyrosine kinase activity
GO:0005524	ATP binding
GO:0019901	protein kinase binding
GO:0019904	protein domain specific binding
GO:0030145	manganese ion binding
GO:0031625	ubiquitin protein ligase binding
GO:0034237	protein kinase A regulatory subunit binding
GO:0106310	protein serine kinase activity

	Biological Process
GO:0001707	mesoderm formation
GO:0001843	neural tube closure
GO:0006397	mRNA processing
GO:0006468	protein phosphorylation
GO:0006611	protein export from nucleus
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0010737	protein kinase A signaling
GO:0016310	phosphorylation
GO:0018105	peptidyl-serine phosphorylation
GO:0032024	positive regulation of insulin secretion
GO:0034605	cellular response to heat
GO:0045542	positive regulation of cholesterol biosynthetic process
GO:0045667	regulation of osteoblast differentiation
GO:0045722	positive regulation of gluconeogenesis
GO:0045879	negative regulation of smoothened signaling pathway
GO:0046827	positive regulation of protein export from nucleus
GO:0048240	sperm capacitation
GO:0050804	modulation of chemical synaptic transmission
GO:0051726	regulation of cell cycle
GO:0061136	regulation of proteasomal protein catabolic process
GO:0070417	cellular response to cold
GO:0070613	regulation of protein processing
GO:0071333	cellular response to glucose stimulus
GO:0071374	cellular response to parathyroid hormone stimulus
GO:0071377	cellular response to glucagon stimulus
GO:0099170	postsynaptic modulation of chemical synaptic transmission
GO:1904262	negative regulation of TORC1 signaling
GO:1904539	negative regulation of glycolytic process through fructose-6-phosphate
GO:1990044	protein localization to lipid droplet
GO:2000810	regulation of bicellular tight junction assembly

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005930	axoneme
GO:0005952	cAMP-dependent protein kinase complex
GO:0016607	nuclear speck
GO:0031594	neuromuscular junction
GO:0036126	sperm flagellum
GO:0044853	plasma membrane raft
GO:0048471	perinuclear region of cytoplasm
GO:0097546	ciliary base
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6yqk, PDBe:6yqk, PDBj:6yqk
PDBsum	6yqk
PubMed	33029876
UniProt	P25321\|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha (Gene Name=PRKACA)

[Back to BioLiP]