Structure of PDB 6yoo Chain A Binding Site BS01

Receptor Information

>6yoo Chain A (length=118) Species: 9606 (Homo sapiens)

SMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKY
LVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNH
EEDYFLYVAYSDESVYGK

Ligand information

>6yoo Chain B (length=10) Species: 9606 (Homo sapiens)

EEAEFVEVEP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6yoo Structure of SAMM50 LIR bound to GABARAPL1
• Resolution: 1.06 Å
• Binding residue (original residue number in PDB): H9 K46 K48 Y49 L50 P52 F104
• Binding residue (residue number reindexed from 1): H10 K47 K49 Y50 L51 P53 F105

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005543 phospholipid binding
• GO:0008429 phosphatidylethanolamine binding
• GO:0030957 Tat protein binding
• GO:0031625 ubiquitin protein ligase binding
• GO:0048487 beta-tubulin binding
• GO:0050811 GABA receptor binding

Biological Process

• GO:0000045 autophagosome assembly
• GO:0000422 autophagy of mitochondrion
• GO:0006914 autophagy
• GO:0006995 cellular response to nitrogen starvation
• GO:0061723 glycophagy
• GO:0097352 autophagosome maturation

Cellular Component

• GO:0000421 autophagosome membrane
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005776 autophagosome
• GO:0005783 endoplasmic reticulum
• GO:0005794 Golgi apparatus
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0016020 membrane
• GO:0030659 cytoplasmic vesicle membrane
• GO:0031410 cytoplasmic vesicle

External links

• PDB: RCSB:6yoo, PDBe:6yoo, PDBj:6yoo
• PDBsum: 6yoo
• UniProt: Q9H0R8|GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=GABARAPL1)