Structure of PDB 6yli Chain A Binding Site BS01

Receptor Information
>6yli Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSMAMSQSNRELVVDFLSYKLSQKGYSWSQFSDEGTESEAVKQALREAGD
EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFS
FGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELY
GNNAA
Ligand information
>6yli Chain B (length=24) Species: 287889 (Trichoplax sp. H2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SPTSEIGRHLAQLGDSYSVRFQNE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yli Ancient and conserved functional interplay between Bcl-2 family proteins in the mitochondrial pathway of apoptosis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		A57 E60 F61 R64 Y65 L72 Q75 L76 Q89 V90 E93 L94 N100 G102 R103 F110 E157 L158 Y159
Binding residue
(residue number reindexed from 1)		A48 E51 F52 R55 Y56 L63 Q66 L67 Q80 V81 E84 L85 N91 G93 R94 F101 E148 L149 Y150
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6yli, PDBe:6yli, PDBj:6yli
PDBsum6yli
PubMed32998881
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]