Structure of PDB 6yld Chain A Binding Site BS01

Receptor Information
>6yld Chain A (length=150) Species: 287889 (Trichoplax sp. H2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQFLVYKNIIKDYIQSRLFNEGLLDGPYRCDIKDVKTKKVSERLKEVGNE
LEGKFKDSFSNMCERLTITDTTAYPTFVGVVNELFSTGINWGRIVAFIVF
SSRLAIHFKRNGMPEYVKSVYGWVARYMHTKLSTWIEANRSWDGFLDHFD
Ligand information
>6yld Chain B (length=24) Species: 287889 (Trichoplax sp. H2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSPTSEIGRHLAQLGDSYSVRFQN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yld Ancient and conserved functional interplay between Bcl-2 family proteins in the mitochondrial pathway of apoptosis.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		V51 E54 L55 F59 S62 F63 M66 R69 L70 G83 V84 E87 L88 G96 R97 F153
Binding residue
(residue number reindexed from 1)		V47 E50 L51 F55 S58 F59 M62 R65 L66 G79 V80 E83 L84 G92 R93 F149
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6yld, PDBe:6yld, PDBj:6yld
PDBsum6yld
PubMed32998881
UniProtA0A369S2N9

[Back to BioLiP]