Structure of PDB 6yl2 Chain A Binding Site BS01

Receptor Information

>6yl2 Chain A (length=192) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SDRRFQLLAAAERLFAERGFLAVRLEDIGAAAGVSGPAIYRHFPNKESLL
VELLVGVSARLLAGARDVTTRSANLAAALDGLIEFHLDFALGEADLIRIQ
DRDLAHLPAVAERQVRKAQRQYVEVWVGVLRELNPGLAEADARLMAHAVF
GLLNSTPHSMKAADSKPARTVRARAVLRAMTVAALSAADRCL

Ligand information

>6yl2 Chain G (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acgttaatgacgattaaccg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6yl2 Structural and DNA binding studies of the transcriptional repressor Rv2506 (BkaR) from Mycobacterium tuberculosis supports a role in L-Leucine catabolism
Resolution	3.15 Å
Binding residue (original residue number in PDB)	R47 L48 Y63 N68 K69
Binding residue (residue number reindexed from 1)	R24 L25 Y40 N45 K46

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0042802	identical protein binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0042783	evasion of host immune response

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6yl2, PDBe:6yl2, PDBj:6yl2
PDBsum	6yl2
PubMed
UniProt	O06169

[Back to BioLiP]