Structure of PDB 6ygd Chain A Binding Site BS01

Receptor Information

>6ygd Chain A (length=159) Species: 4932 (Saccharomyces cerevisiae)

MEIVYKPLDIRNEEQFASIKKLIDADLSEPYSIYVYRYFLNQWPELTYIA
VDNKSGTPNIPIGCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLV
EIAIDKMQREHCDEIMLETEVENSAALNLYEGMGFIRMKRMFRYYLNEGD
AFKLILPLT

Ligand information

>6ygd Chain D (length=6) Species: 11008 (Saccharomyces cerevisiae virus L-A)

MLRFVG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ygd Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
• Resolution: 2.752 Å
• Binding residue (original residue number in PDB): L27 E29 Y31 F39 Y80 G82 E118 Y144 Y145
• Binding residue (residue number reindexed from 1): L27 E29 Y31 F39 Y80 G82 E118 Y144 Y145

Enzymatic activity

• Enzyme Commision number: 2.3.1.256: N-terminal methionine N(alpha)-acetyltransferase NatC.

Gene Ontology

Molecular Function

• GO:0004596 peptide alpha-N-acetyltransferase activity
• GO:0005515 protein binding
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0120518 peptide-methionine-alpha-N-acetyltransferase activity

Biological Process

• GO:0017196 N-terminal peptidyl-methionine acetylation
• GO:0032880 regulation of protein localization

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031417 NatC complex

External links

• PDB: RCSB:6ygd, PDBe:6ygd, PDBj:6ygd
• PDBsum: 6ygd
• PubMed: 33139728
• UniProt: Q03503|NAA30_YEAST N-alpha-acetyltransferase 30 (Gene Name=MAK3)