Structure of PDB 6ygc Chain A Binding Site BS01

Receptor Information
>6ygc Chain A (length=159) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEIVYKPLDIRNEEQFASIKKLIDADLSEPYSIYVYRYFLNQWPELTYIA
VDNKSGTPNIPIGCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLV
EIAIDKMQREHCDEIMLETEVENSAALNLYEGMGFIRMKRMFRYYLNEGD
AFKLILPLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ygc Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
Resolution2.994 Å
Binding residue
(original residue number in PDB)		E29 Y31 Y80 G82 E118 Y144 Y145
Binding residue
(residue number reindexed from 1)		E29 Y31 Y80 G82 E118 Y144 Y145
Enzymatic activity
Enzyme Commision number 2.3.1.256: N-terminal methionine N(alpha)-acetyltransferase NatC.
Gene Ontology
Molecular Function
GO:0004596 peptide alpha-N-acetyltransferase activity
GO:0005515 protein binding
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0120518 peptide-methionine-alpha-N-acetyltransferase activity
Biological Process
GO:0017196 N-terminal peptidyl-methionine acetylation
GO:0032880 regulation of protein localization
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0031417 NatC complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ygc, PDBe:6ygc, PDBj:6ygc
PDBsum6ygc
PubMed33139728
UniProtQ03503|NAA30_YEAST N-alpha-acetyltransferase 30 (Gene Name=MAK3)

[Back to BioLiP]