Structure of PDB 6ycs Chain A Binding Site BS01

Receptor Information
>6ycs Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS
QLKEQISDIDDAVRKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ycs Origins of the Increased Affinity of Phosphorothioate-Modified Therapeutic Nucleic Acids for Proteins.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		R75 F77 K80 L82 R86 W89 M90 P92 P98 G99 R100 K101 S104 N106
Binding residue
(residue number reindexed from 1)		R14 F16 K19 L21 R25 W28 M29 P31 P37 G38 R39 K40 S43 N45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003713 transcription coactivator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0060261 positive regulation of transcription initiation by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ycs, PDBe:6ycs, PDBj:6ycs
PDBsum6ycs
PubMed32202774
UniProtP53999|TCP4_HUMAN Activated RNA polymerase II transcriptional coactivator p15 (Gene Name=SUB1)

[Back to BioLiP]