Structure of PDB 6y9o Chain A Binding Site BS01

Receptor Information
>6y9o Chain A (length=97) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPTSTLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKV
GHVILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEFNVML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y9o Deciphering the Unexpected Binding Capacity of the Third PDZ Domain of Whirlin to Various Cochlear Hair Cell Partners.
Resolution1.632 Å
Binding residue
(original residue number in PDB)		T824 L825 G826 I827 A828 I829 E830 G831 R836 T844 Q846 H876
Binding residue
(residue number reindexed from 1)		T15 L16 G17 I18 A19 I20 E21 G22 R27 T35 Q37 H67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6y9o, PDBe:6y9o, PDBj:6y9o
PDBsum6y9o
PubMed32971111
UniProtQ80VW5|WHRN_MOUSE Whirlin (Gene Name=Whrn)

[Back to BioLiP]