Structure of PDB 6y93 Chain A Binding Site BS01

Receptor Information
>6y93 Chain A (length=105) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELSSIEEAHAYARLLELHDLTQEALAQRLGKGQSTIANKLRLLKLPQPVQ
EAIMEKKITERHARALIPLKQPELQVTLLTEIIEKSLNVKQTEDRVVKML
EQGQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y93 Diversification of DNA-Binding Specificity by Permissive and Specificity-Switching Mutations in the ParB/Noc Protein Family.
Resolution2.23 Å
Binding residue
(original residue number in PDB)		T146 Q147 Q158 A162 N163 R166 R186
Binding residue
(residue number reindexed from 1)		T21 Q22 Q33 A37 N38 R41 R61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6y93, PDBe:6y93, PDBj:6y93
PDBsum6y93
PubMed32698006
UniProtP37524|NOC_BACSU Nucleoid occlusion protein (Gene Name=noc)

[Back to BioLiP]