Structure of PDB 6y38 Chain A Binding Site BS01

Receptor Information
>6y38 Chain A (length=91) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSTLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGH
VILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y38 Deciphering the Unexpected Binding Capacity of the Third PDZ Domain of Whirlin to Various Cochlear Hair Cell Partners.
Resolution1.697 Å
Binding residue
(original residue number in PDB)		G826 I827 A828 I829 E830 G831 N834 T835 R836 Q837 H876 K877
Binding residue
(residue number reindexed from 1)		G15 I16 A17 I18 E19 G20 N23 T24 R25 Q26 H65 K66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6y38, PDBe:6y38, PDBj:6y38
PDBsum6y38
PubMed32971111
UniProtQ80VW5|WHRN_MOUSE Whirlin (Gene Name=Whrn)

[Back to BioLiP]