Structure of PDB 6xzz Chain A Binding Site BS01

Receptor Information
>6xzz Chain A (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PDSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACS
GLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMA
VMATAMYLQMEHVVDTCRKFIKAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xzz Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone.
Resolution1.39 Å
Binding residue
(original residue number in PDB)
D6 Q8 I9 Q10 F11 T12
Binding residue
(residue number reindexed from 1)
D2 Q4 I5 Q6 F7 T8
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xzz, PDBe:6xzz, PDBj:6xzz
PDBsum6xzz
PubMed33708392
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]