Structure of PDB 6xyx Chain A Binding Site BS01

Receptor Information
>6xyx Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSG
LFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAV
MATAMYLQMEHVVDTCRKFI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xyx Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone.
Resolution1.44 Å
Binding residue
(original residue number in PDB)
M51 A52 Y58 H116
Binding residue
(residue number reindexed from 1)
M46 A47 Y53 H111
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xyx, PDBe:6xyx, PDBj:6xyx
PDBsum6xyx
PubMed33708392
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]